Bacterial taxon 400667
Locus A1S_2128
Protein ABO12555.1
aconitate hydratase 2
Acinetobacter baumannii ATCC 17978
Length 245 aa, Gene n/a, UniProt n/a
>ABO12555.1|Acinetobacter baumannii ATCC 17978|aconitate hydratase 2
MLGGYNVAPLVELLDDAELGSLAAEALKKTLLVFDAFHDVADKAKAGNANAKAVLQSWADAEWFTSRKDVPEEIKITVFKVTGETNTDDLSPAQDAWSRPDIPLHANAMLKNERDGINPEKPGEVGPLSQIKELIAKGNQVAYVGDVVGTGSSRKSATNSVLWFFGDEIAHIPNKKDGGVCLGGKIAPIFFNTMEDAGALPVEIDVSNMNMGDEVTLKIDHAAAKVTAFKNGEQIAESELKTPVL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.35 | 2.8e-9 | ●●●●○ -3.2 | -3.204275384329088 | 24895306 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)