Bacterial taxon 400667
Locus A1S_2301
Protein ABO12724.2
Amino acid ABC transporter permease protein
Acinetobacter baumannii ATCC 17978
Length 229 aa, Gene n/a, UniProt n/a
>ABO12724.2|Acinetobacter baumannii ATCC 17978|Amino acid ABC transporter permease protein
MSFSGYGPLLLSGTWMTIQLALLSLLLSVIIGLIGASSKLSNIKALRYIATAYTTLIRSVPDLVIMLLLFYSLQLGLNQITEALQMDQIDINPFVAGVITLAFIYGAYFTETFRGAFQSVPRGQIEAAMAYGMTPWQVFHRVLFPQMMRFALPGIGNNWQVLIKATALVSIIGLTDIVKITQDAGRSTMQLFFFSIVAAAIYLAITTVSNLILMWLERHYSAGVRKGQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.43 | 0.018 | ●○○○○ -0.41 | -0.40925522297065103 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)