Bacterial taxon 400667
Locus A1S_1068
Protein ABO11499.1
argininosuccinate synthetase
Acinetobacter baumannii ATCC 17978
Length 148 aa, Gene argG, UniProt A3M3K6
>ABO11499.1|Acinetobacter baumannii ATCC 17978|argininosuccinate synthetase
MALLHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQALMLRETAQRWVAKAITGEVTLELRRGNDYTIMNTESPNLTYEAERLTMEKGDSMFTPMDRIGQLTMRNLDITDTRAKLGIYTDAGLLSIGQGSAVPQLDNKKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.76 | 3.4e-8 | ●○○○○ -0.89 | -0.885107084758573 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)