Bacterial taxon 400667
Locus A1S_1452
Protein ABO11880.2
arsenate reductase
Acinetobacter baumannii ATCC 17978
Length 142 aa, Gene n/a, UniProt n/a
>ABO11880.2|Acinetobacter baumannii ATCC 17978|arsenate reductase
MTELVKIYHNPACGTSRNTLALIRHAGIEPIVIEYLQTPPSKDELIQLIKDSNLTVREAIRKNVDPYKDLELEQADWTDEQLIEFMVQYPILINRPFVVTPKGTRLCRPSEMVLDILDSQNLGYFAKEDGEVIIDEQGRRLK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.39 | 0.00031 | ●●○○○ -1.81 | -1.8106150632505862 | 24895306 |
Retrieved 1 of 1 entries in 13 ms
(Link to these results)