Bacterial taxon 400667
Locus A1S_1453
Protein ABO11881.1
arsenite inducible repressor
Acinetobacter baumannii ATCC 17978
Length 109 aa, Gene n/a, UniProt n/a
>ABO11881.1|Acinetobacter baumannii ATCC 17978|arsenite inducible repressor
MINQVDFFKCLSDQTRLNILKLVLNKQNICVCELTEQLELSQPKISRHLALLRTHGVLLDERKGQWVYYSLNPDLPVWALDILKVIENDESGTKVKQQDQSFITTTCCD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.41 | 0.02 | ○○○○○ 0.81 | 0.8071565003763628 | 24895306 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)