Bacterial taxon 400667
Locus A1S_0686
Protein ABO11130.2
ATP-phosphoribosyltransferase
Acinetobacter baumannii ATCC 17978
Length 227 aa, Gene n/a, UniProt n/a
>ABO11130.2|Acinetobacter baumannii ATCC 17978|ATP-phosphoribosyltransferase
MNDVRNDDPNFNVMGNFDHGLTLALSKGRILKETLPLLATAGINLLEDPEKSRKLIFPTTHKQVRILILRASDVPTYVENGAADLGVAGKDVLMEHGAQHVYELLDLQIAKCKLMTAGKVGMERPKGRLKIATKYVNLTRQYYASLGEQVDVIKLYGSMELAPLVGLGDYIVDVVDTGNTLRANGLEPLEEICKVSSRLIVNKASFKRKQVLLNPIISQLEQAVQSR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.81 | 5.4e-38 | ●●●○○ -2.42 | -2.4236680461913855 | 24895306 |
Retrieved 1 of 1 entries in 10.7 ms
(Link to these results)