Bacterial taxon 400667
Locus A1S_1861
Protein ABO12288.1
benzoate dioxygenase large subunit
Acinetobacter baumannii ATCC 17978
Length 133 aa, Gene n/a, UniProt n/a
>ABO12288.1|Acinetobacter baumannii ATCC 17978|benzoate dioxygenase large subunit
MNSIIPTHNIGIDYDALVKSDRAHTSLYKDERIFDEEMEKIFYSTWVWVAHASEIPEAGSYKTINIGKQPVVVVRDRKKKVHVLLNRCRHRAATVCEHKKGKLTVLYAHITVGVMHLMAVYVACHLRKVTAIV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.82 | 1.2e-38 | ●●●○○ -2.44 | -2.437180692617603 | 24895306 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)