Bacterial taxon 400667
Locus A1S_2682
Protein ABO13095.2
cell division protein
Acinetobacter baumannii ATCC 17978
Length 216 aa, Gene rlmE, UniProt A3M851
>ABO13095.2|Acinetobacter baumannii ATCC 17978|cell division protein
MATRITNQKLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVVDLGAAPGSWSQIAGKLVGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGRQVDIVISDMAPNTSGNRAVDQPRQIYLCELALDFAQKVLGPNGQFVVKVFQGAGFDEFRKQVVDSFDVLKTAKPAASRARSKEVFLVGQGRKKALQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.73 | 0.0032 | ●○○○○ -0.85 | -0.8478526900531931 | 24895306 |
Retrieved 1 of 1 entries in 12.6 ms
(Link to these results)