Bacterial taxon 400667
Locus A1S_0575
Protein ABO11028.2
cysteine synthase B
Acinetobacter baumannii ATCC 17978
Length 304 aa, Gene n/a, UniProt n/a
>ABO11028.2|Acinetobacter baumannii ATCC 17978|cysteine synthase B
MSNTQPDFLADEFLLDHYVGKTPLVRLQRLACHTQATVLAKLEGNNPAGSVKDRPAYNMIMQAEKRGQIKPGDTLVEATSGNTGIALAMVAAMRGYKMKLIMPGNSSQERKDAMRAYGAELIEAPNMEAARDMALQMQAEGLGLVLNQFGNPDNVEAHYLTTGPEIWKQTGGKITHFVSSMGTTGTIMGVSKYLKEQNPDIQIIGLQPSEGSNIAGIRRWPQEYLPTIFEPKRVDQIMDIPQIEAEKTARRLAREEGISAGTSSGGAVWASVKIAEENPDAVIVCIICDRGDRYLSTGLFSVQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.74 | 4.1e-11 | ●●●○○ -2.32 | -2.31641439083992 | 24895306 |
Retrieved 1 of 1 entries in 25.5 ms
(Link to these results)