Bacterial taxon 400667
Locus A1S_1637
Protein ABO12064.1
DNA-binding protein HU-beta
Acinetobacter baumannii ATCC 17978
Length 90 aa, Gene n/a, UniProt n/a
>ABO12064.1|Acinetobacter baumannii ATCC 17978|DNA-binding protein HU-beta
MNKSELIDAIAEKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.04 | 1.1e-46 | ●●●●● -4.22 | -4.217791967668096 | 24895306 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)