Bacterial taxon 400667
Locus A1S_3329
Protein ABO13718.2
EsvJ
Acinetobacter baumannii ATCC 17978
Length 230 aa, Gene n/a, UniProt n/a
>ABO13718.2|Acinetobacter baumannii ATCC 17978|EsvJ
MHTRRILLAFSLAASAASVAFADYQNINQSTDSDRLEQLSKTLSQGSYTHPDDLDLPASAKVSVTLREKTVELNNDSLAKKYGTTTAKNSFKTSSSNPYSWLVSHPLPDTVRVSSNFGGRTMGGRAEHHGGLDMAAPSGTPIYATGPGIVTKSGWGTGYGQYVEINHGNGYLTRYAHASRLMVRVGDQVSAGDHIANVGCTGRCTGPHLHYEVVKDGQRKNPSTYLAMLP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.5 | 0.00092 | ●○○○○ -0.51 | -0.5140544647211782 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)