Bacterial taxon 400667
Locus A1S_1586
Protein ABO12013.2
EsvK1
Acinetobacter baumannii ATCC 17978
Length 128 aa, Gene n/a, UniProt n/a
>ABO12013.2|Acinetobacter baumannii ATCC 17978|EsvK1
MKLQTFKNKLQTLQAPAQAQKNPKQNNWGSGRGGRPWRRLKAKIHLRDEWTCQCCGIVTKDLELDHIMNVARGGTDDESNLQSLCVPCHKKKTQQESRQGGEVKSSKPFAVGHRPPSHAQKKFPFRKS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.51 | 0.0001 | ○○○○○ 2.41 | 2.414226764544047 | 24895306 |
Retrieved 1 of 1 entries in 11.3 ms
(Link to these results)