Bacterial taxon 400667
Locus A1S_2024
Protein ABO12451.1
Glutamate 5-kinase
Acinetobacter baumannii ATCC 17978
Length 122 aa, Gene n/a, UniProt n/a
>ABO12451.1|Acinetobacter baumannii ATCC 17978|Glutamate 5-kinase
MGLRDEIQADIAEAFNDDLADAVHTFTCERISKTNWDPKTETYVEVKENYSGRGVLFGSYSQYEIETLGVLATDKKATVLQNEVSMTPKIDDEWLTALGSFRVIHIQQDPASTIWKCQLRKV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.77 | 0.0024 | ●○○○○ -0.91 | -0.9120283225671354 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)