Bacterial taxon 400667
Locus A1S_3337
Protein ABO13726.2
glutathione synthetase
Acinetobacter baumannii ATCC 17978
Length 314 aa, Gene n/a, UniProt n/a
>ABO13726.2|Acinetobacter baumannii ATCC 17978|glutathione synthetase
MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFEDYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRDCNEKLFATQFPELQVPTLVTSQQSLIREFITEYGDVIVKPLDGMGGMGIFRLYQDGVNIGSTLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGLGQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSIADDLFDVLEAGRPA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.36 | 0.028 | ●○○○○ -0.3 | -0.3027500503197941 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)