Bacterial taxon 400667
Locus A1S_0256
Protein ABO10731.2
high affinity phosphate uptake transcriptional repressor
Acinetobacter baumannii ATCC 17978
Length 234 aa, Gene n/a, UniProt n/a
>ABO10731.2|Acinetobacter baumannii ATCC 17978|high affinity phosphate uptake transcriptional repressor
MLSHHISSQFNEDLQDVNTKFMTMGGLVEQQVANAIHSLLDTDANLAIDVQFKDNAVNQYERDIDEGLTLILARRHPAAIDLRMVIAMSKANTDLERIGDEAAKIARIAQNLCEEGGSPRGYMETRHIGNQVRVMIHDALDAFARLDADQALRVLLADADIDREYQSATRTLMTYMIEDPRHIARVINVMWVLRSLERIGDHARNIAEQVIYMAKGFDARHTKIEEIEAKVHEK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.07 | 1.5e-16 | ●●●○○ -2.8 | -2.7999998657058556 | 24895306 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)