Bacterial taxon 400667
Locus A1S_0688
Protein ABO11132.2
histidinol-phosphate aminotransferase
Acinetobacter baumannii ATCC 17978
Length 361 aa, Gene hisC, UniProt A3M2I8
>ABO11132.2|Acinetobacter baumannii ATCC 17978|histidinol-phosphate aminotransferase
MTVSTAQMRFWSPEVRELEPYVPGEQPKIQNLLKLNTNENPYPPSPKVVEAVQAVLHEQADVLRLYPDPDATALKQAIAKQQNIDVSQVFVGNGSDEVLAHIFKAFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLNENFEIDVRDYTQPNGGVIITNPNAPTSIALSLAEIEQVLQANPDRVVVIDEAYVDFGAESAVSLINRYENLVVCQTTSKSRSLAGLRVGFAIAQSHLIAALETVKNSFNSYPIDRFAIAAAVASFEDQVYFEEQCQKVITSREKLVRDLTVLGFNVLPSKANFIFATHSQHDAGQLAQKLREQGIIVRYFNKPRINQFLRITVGTDEQNARLVQTLKQDIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.1 | 1.3e-43 | ●●●○○ -2.85 | -2.845207786479958 | 24895306 |
Retrieved 1 of 1 entries in 118 ms
(Link to these results)