Bacterial taxon 400667
Locus A1S_0060
Protein ABO10555.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 275 aa, Gene n/a, UniProt n/a
>ABO10555.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MFSVLSSIYHKEQPEHFNTCMESIWDNQTLKPTEIVLIEDGPLTPELDQVIAHWQKKLGNVLRVTKLEKNVGTGKAKNIGLQECNYDIVSIVDTDDIYVPERFEKQIKFLQQNPEISIVGGQIFEFIEDIGNPVGMRKVPLSNEELRNYAKKQSPFNNMTITYRKSHILEVGGYQHHLWMEDYNLFLRVIAKGYKIENLPDVLVYARIDNGMHGRRKGLQYIKSEKQLLDLKKQLKLQNPLYANMLFLVRSAFRLLPANLLGTIYNTFLRKDIKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.11 | 6.1e-51 | ●●●●● -4.32 | -4.3222103073941325 | 24895306 |
Retrieved 1 of 1 entries in 10 ms
(Link to these results)