Bacterial taxon 400667
Locus A1S_0264
Protein ABO10739.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 169 aa, Gene n/a, UniProt n/a
>ABO10739.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MWQISRTVPELQQSLLQSEQQYANLNDQLVALQRQIQNQPSHNSKTTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQFIYAVDHLTQLQQTLPQYGIAPALQHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQNIDKNIQQALKQPKFEMDQSEAVSWWKMVPY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.4 | 0.019 | ●○○○○ -0.36 | -0.3626240256793903 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)