Bacterial taxon 400667
Locus A1S_0419
Protein ABO10874.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 169 aa, Gene n/a, UniProt n/a
>ABO10874.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MDTVRIKQAEQENLGQNAAIYCSGAKSCEFERLNDITVVDAQTRRISNQAIHQGIVRLNGSVLSQSNSLYLSVPAKQYEVVIRYYPISPDRAETIHVIHQFKANHRYMFKMYRDKSNRSGSLLNVSVPDPLCVDLEQDGRVIRRFCRPFDVTTGLGEFLEQKKLTPRQS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.19 | 1.3e-51 | ●●●○○ -2.98 | -2.9799040767685074 | 24895306 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)