Bacterial taxon 400667
Locus A1S_0438
Protein ABO10893.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 149 aa, Gene n/a, UniProt n/a
>ABO10893.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MDNIGIWVTVIIVLFVLGSIFGLRVSPREKALGIMRDKARKMGLHPRVIAAPEWTHVPMATEKRASMVAYYSVLIPDARLPLMRARVIDGKLKVVQGDEKFNDSPIALKGIYAIDMQANCVGLYWDEESDLKATQLDEMKAYLLALAEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.07 | 8.6e-10 | ●●○○○ -1.34 | -1.3365703594599248 | 24895306 |
Retrieved 1 of 1 entries in 2.5 ms
(Link to these results)