Bacterial taxon 400667
Locus A1S_0484
Protein ABO10939.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 206 aa, Gene n/a, UniProt n/a
>ABO10939.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MSKIEDVVKLGPVIPVLAFDSAEQGEHVSRALHAGGVKVLEITLRTAAGLAAIERASQLADDIVVGVGTITKPEHCAQAKKAGAKFGVSPGLTKDLHLAAQDAGLPLLPGVMTPSDLIQAIELGYDIVKFFPAQQAGGVEMLKAFYGPFPNLRFCPTGGITAETAPDFLKQPNVVCVGGSWLTPKPVVAAQDWAEITRLAQIASQL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.7 | 3.1e-7 | ○○○○○ 1.24 | 1.2414617675433886 | 24895306 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)