Bacterial taxon 400667
Locus A1S_0576
Protein ABO11029.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 272 aa, Gene n/a, UniProt n/a
>ABO11029.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MRFPTLVFDIETLTDLKAGAHLYHLDLPETDVEQALTKIRRQESGMDFQRLPLHEIVCISGLWIDESGFRLFSFSREHYSEAEILQKFLSIFDKRHPTLVSWNGSQFDLPVILFRAMYHGLSAPGLFDQGELDSQKRFNNYQNRYHHRHIDLMDVMAMFNGRNFQKLDDVACILGLPGKRGESGYHVPEYVRTEQWLKLTSYCEGDVLNTWFIYLRWLLLKGQMNVDEHNHWISSSIEYLQTMPQQADFLEVWQRTSKHTEFTSHYFNPLNF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.35 | 0.034 | ●○○○○ -0.29 | -0.287207857267592 | 24895306 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)