Bacterial taxon 400667
Locus A1S_1036
Protein ABO11468.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 94 aa, Gene n/a, UniProt n/a
>ABO11468.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MSEQVMVELRLIEQTFRLATTSDKREELERAAELLNEKFNDMRRSAPRVEHNKLVIMVALQLTQEVLSLNKSLQEYAHCERLLQTILEDVEQIV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.2 | 5.8e-6 | ●●○○○ -1.53 | -1.5299054848729565 | 24895306 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)