Bacterial taxon 400667
Locus A1S_1688
Protein ABO12115.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 101 aa, Gene n/a, UniProt A3M5C1
>ABO12115.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MHCDIYRSSKKDEMYIYIARPNYPDETEQADPFEKVPEAVLQAFGRATFVMHLELAPTRKLARVNVLHVLDSLQTKGFFIQMPPEGLINPNAVEPEGLRGA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.11 | 2.9e-16 | ○○○○○ 1.84 | 1.8405974144064718 | 24895306 |
Retrieved 1 of 1 entries in 49.7 ms
(Link to these results)