Bacterial taxon 400667   Locus A1S_1803   Protein ABO12230.2

hypothetical protein

Acinetobacter baumannii ATCC 17978

Length 144 aa, Gene n/a, UniProt n/a

>ABO12230.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MQILLLLLTILGGMGLSVEAGLLGPLGKEVGELWATFSIFGVGAALTFLLMLFFSPRNSPSFFTLPSWQLLGGVLGPAYVIILTITTPIIGIAMTMIGILAGQVSKSLIIDHYGLLGTPHRKVDRKRVVALIFIVVALVLVSKA

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-0,210,66●○○○○ -0,09-0.0871254651753723724895306
Retrieved 1 of 1 entries in 0,5 ms (Link to these results)