Bacterial taxon 400667
Locus A1S_2188
Protein ABO12615.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 126 aa, Gene n/a, UniProt n/a
>ABO12615.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MTKRAPTEQEIDDLIFAWKVAKYVKSNAIVYAKNRQTIGVGAGQMSRVNSARIAAIKAEHAGLVVEGAVMASDAFFPFRDGIDNAAKAGIKCIIQPGGSMRDEEVIAAADEAGIAMVFTGMRHFRH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.54 | 1.1e-44 | ●●●●● -4.95 | -4.946226183404844 | 24895306 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)