Bacterial taxon 400667
Locus A1S_2655
Protein ABO13071.2
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 127 aa, Gene n/a, UniProt n/a
>ABO13071.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MPAFLTDDWFATVEKLTAEAGDLNLPPALANLAINLVVTDASGNTELALDGGKIQKGLSSNAKTTLNMDAETLRKVFLEFDMAAAMQAFMTGKIKVQGDMSQLMALQTAKPSQEQKDLFKKVLEQTA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.78 | 9.9e-41 | ○○○○○ 2.81 | 2.8133466748173768 | 24895306 |
Retrieved 1 of 1 entries in 13.3 ms
(Link to these results)