Bacterial taxon 400667   Locus A1S_2806   Protein ABO13212.2

hypothetical protein

Acinetobacter baumannii ATCC 17978

Length 167 aa, Gene n/a, UniProt n/a

>ABO13212.2|Acinetobacter baumannii ATCC 17978|hypothetical protein
MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTGKTPRGWHRVAKKFGMQSPKNAVFIARQPTGEVYSSELAAQFPERDWILSRILWLDGLEEGFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSEQSLT

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-1.287.1e-18●●○○○ -1.65-1.650125918978151624895306
Retrieved 1 of 1 entries in 305.7 ms (Link to these results)