Bacterial taxon 400667
Locus A1S_3173
Protein ABO13570.1
hypothetical protein
Acinetobacter baumannii ATCC 17978
Length 127 aa, Gene n/a, UniProt n/a
>ABO13570.1|Acinetobacter baumannii ATCC 17978|hypothetical protein
MSRQVIHTENAPAAIGTYSQAILVGNTLYLSGQIGLDPYSMELVDGIEAQIRRVFDNLKAVCEAAGGTLADIAKLNIFLTDLSNFQLVNQIMGEYFAQPYPARAALGVASLPKGALVEMDGIVIINQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.59 | 0.00017 | ●○○○○ -0.65 | -0.6460614478513766 | 24895306 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)