Bacterial taxon 400667
Locus A1S_3235
Protein ABO13625.2
imidazole glycerol phosphate synthetase glutamine amidotransferase subunit
Acinetobacter baumannii ATCC 17978
Length 205 aa, Gene n/a, UniProt n/a
>ABO13625.2|Acinetobacter baumannii ATCC 17978|imidazole glycerol phosphate synthetase glutamine amidotransferase subunit
MTRIALLDYGMGNLHSAAKALEYVGATVDVTNDPKLIAQADKIVFPGVGAMRDCMQGMREAGIDEVVRKAAFNKPVLAICVGMQALLQSSEENGGVDALGIFDGVVKHFPQMEGLKVPHMGWNQVHQMDPSHPMWNNIEQDARFYFVHSYYVEPKDENLVAATCEYGVNFCTAIHKDNLFATQFHPEKSHTAGLQLLKNFVEWNI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3 | 1.1e-45 | ●●●●● -4.16 | -4.162050109541977 | 24895306 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)