Bacterial taxon 400667
Locus A1S_1529
Protein ABO11956.2
leucine-responsive regulatory protein
Acinetobacter baumannii ATCC 17978
Length 162 aa, Gene n/a, UniProt n/a
>ABO11956.2|Acinetobacter baumannii ATCC 17978|leucine-responsive regulatory protein
MNGPLLSLDRTDLKILDILQTDGRISNSRLAELVNLSPTAVMARVQKLTKDEFILGYEAKLNPVKLNANFLVFVEVLLDKTTPNVLDEFIDAVVHYPEIVECHMVSGGFDFLIKLRSGSMEEFRRIAGQVLWQLPGVKETRSYPVMQVVKDSSKIKIKTKNK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.03 | 0.00011 | ○○○○○ 3.17 | 3.171841247972437 | 24895306 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)