Bacterial taxon 400667
Locus A1S_1739
Protein ABO12166.1
major facilitator superfamily MFS_1
Acinetobacter baumannii ATCC 17978
Length 191 aa, Gene n/a, UniProt n/a
>ABO12166.1|Acinetobacter baumannii ATCC 17978|major facilitator superfamily MFS_1
MLWLCCFTSLLVFYLLTSWMPTILKTAGFSTQQFSLIAAIFPFGGVIGATIMGWYMDKLNPTTVIKYSYLIAFVLFIVAGLVSSNIFLLGLTIFLIGALLAGAQSSLLPLAAMFYPAVCRAVGVSWMHGIGRIGAILGAFFGSLIFTFSLSLSGIFFILAIPTFISFIALSLKVIYEKSKHKQVLKLEESL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 3.58 | 3.7e-33 | ○○○○○ 5.44 | 5.436191041999877 | 24895306 |
Retrieved 1 of 1 entries in 49.5 ms
(Link to these results)