Bacterial taxon 400667
Locus A1S_1818
Protein ABO12245.2
MaoC-like dehydratase
Acinetobacter baumannii ATCC 17978
Length 153 aa, Gene n/a, UniProt n/a
>ABO12245.2|Acinetobacter baumannii ATCC 17978|MaoC-like dehydratase
MTKNTLSIDQLVELQGQALGSSQWMTIDQSMINTFADVTQDHQFIHVDEEAARQTPFGGTIAHGFLTLSLLSAMAAQVLPTVQGQKSGVNYGINNLRFISPVHSGKRVRGNFHLKNVSQKNKGSYQLIMEVTIEIEDQAKPALVTEWLTLVNV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.84 | 3.8e-10 | ●●●○○ -2.46 | -2.4629700541869126 | 24895306 |
Retrieved 1 of 1 entries in 77.5 ms
(Link to these results)