Bacterial taxon 400667   Locus A1S_1144   Protein ABO11574.2

merops peptidase family S24

Acinetobacter baumannii ATCC 17978

Length 263 aa, Gene n/a, UniProt n/a

>ABO11574.2|Acinetobacter baumannii ATCC 17978|merops peptidase family S24
MTPKNLLKVERNILPKIELVQLKIDSKILPTVEKKPILMEDAKYKDFADRLNALMKAKDSPIKTINELKNAIGVSYEMARRYTLGSAKPRIEKLQTLADIFGVEISYLDHGTKLDNNIDLSDKVGFEGRRVPVISWVAAGSFTPIETVLKDTEIEEYLPPNKRCGKNGYALKVVGYSMAPTFLPGDRIYVNPDIQTFDLKTDDLVIVACAGDSEATFKRLIIEGEGTSKFLEPLNPDWPDKIIKLSEDCRLVGKVVGLYRDIY
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-2.586.4e-40●●●●○ -3.54-3.53869933697145324895306
Retrieved 1 of 1 entries in 18.9 ms (Link to these results)