Bacterial taxon 400667
Locus A1S_0470
Protein ABO10925.2
methionine biosynthesis protein
Acinetobacter baumannii ATCC 17978
Length 197 aa, Gene n/a, UniProt n/a
>ABO10925.2|Acinetobacter baumannii ATCC 17978|methionine biosynthesis protein
MRIDQQLAEKWIKPGSSVLDLGCGDGELLAHMSQKHQIRAYGLEIDQEKIAIAVSRGLNIIQQDLNLGLSRFADQSFDYVVMAQALQAVDAPDVLLRDMVRVGKQAIITFPNFAHWKTRSFLALKGMMPVSDALPYMWYNTPNIHLCTFKDFEALCAENQIQIINRLAVNGNQQGSLLSKHVPNLFGEVAIYRVSAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.06 | 2.5e-15 | ●●○○○ -1.33 | -1.3315173093484223 | 24895306 |
Retrieved 1 of 1 entries in 12 ms
(Link to these results)