Bacterial taxon 400667
Locus A1S_1997
Protein ABO12424.2
molybdopterin converting factor large subunit
Acinetobacter baumannii ATCC 17978
Length 162 aa, Gene n/a, UniProt n/a
>ABO12424.2|Acinetobacter baumannii ATCC 17978|molybdopterin converting factor large subunit
MKEFARIQEQALSLDTFDPIQSFPECGGIDIFMGTVRNHHEGKAVKALKYTSYKPLAEKMIREIELEIEKKYQVSYVRVVHRIGYLDVGETAIIAIAYAAHRREAFQACEEAVERVKHEVPVFKEEFFTDGTSHYVEGCCIRKDAPHDHKHHHHHAGHEHSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.83 | 0.00048 | ○○○○○ 1.43 | 1.4318406335758858 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)