Bacterial taxon 400667   Locus A1S_0989   Protein ABO11421.2

monofunctional biosynthetic peptidoglycan transglycosylase

Acinetobacter baumannii ATCC 17978

Length 225 aa, Gene mtgA, UniProt A3M3C7

>ABO11421.2|Acinetobacter baumannii ATCC 17978|monofunctional biosynthetic peptidoglycan transglycosylase
MKAFIVRVLLIFIGAILFIQLWIFSSLVWWRTHEVDTTMFMRIDYWSDTSEPIIHEWLDYDDISDNFKHAILAGEDAKFIHHHGFDWDGIRFALERNNEQGEVVAGGSTVSQQLAKNLFLYNKRSFIRKGQETVATWMMERMWSKRRILEVYMNSVEFGKNLYGVEAAAQYYYGKSAKNLTREQAAFLAALLPDPKYYQDHRNDRKLQYRKRVILRYMNSTQIPE

 

Show protein visualisation   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-0.040.94○○○○○ 0.160.1583615535928844524895306
Retrieved 1 of 1 entries in 0.4 ms (Link to these results)