Bacterial taxon 400667
Locus A1S_3340
Protein ABO13729.1
orotate phosphoribosyltransferase
Acinetobacter baumannii ATCC 17978
Length 216 aa, Gene pyrE, UniProt A3M9Y5
>ABO13729.1|Acinetobacter baumannii ATCC 17978|orotate phosphoribosyltransferase
MTTPVSFHPQAFIELALSRGVLKFGEFTLKSGRVSPYFFNAGLLNDGEALSLLAQGYADKLTQCENVDVIFGPAYKGIPFVAATAVALSQVHNKSVPWGFNRKEAKDHGEGGVLVGAAVEGKKVWIIDDVITAGTAIREVVTILKNAGATIAGVLVALDRQERGQGELSAIQEVQKELEIPVHALITMKDLMDYLEAKGEKEALANMQAYREKYGI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.13 | 1.8e-32 | ●●●●● -4.34 | -4.341979482986927 | 24895306 |
Retrieved 1 of 1 entries in 27.9 ms
(Link to these results)