Bacterial taxon 400667
Locus A1S_1639
Protein ABO12066.1
peptidyl-prolyl cis-trans isomerase precursor
Acinetobacter baumannii ATCC 17978
Length 180 aa, Gene n/a, UniProt n/a
>ABO12066.1|Acinetobacter baumannii ATCC 17978|peptidyl-prolyl cis-trans isomerase precursor
MFNDDVKNGDRNASSNIQLANGDTVWVKVRDYHAAGVKPLAQAMNEVKAKVIDEKARKAAQAKIATMLTEFKTQPAEQVVAKNKVAFESAGVFTRSQGLKRAIERAAFSVPTPKPGMWSVTTANLPNELVVVAVSNVNSAAVNAMPADQLQQLKQLYRQSRGQQILEDYSEYLKSHAKIK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.21 | 0.017 | ○○○○○ 1.99 | 1.9858325413436053 | 24895306 |
Retrieved 1 of 1 entries in 158.3 ms
(Link to these results)