Bacterial taxon 400667   Locus A1S_2028   Protein ABO12455.2

phage putative head morphogenesis protein

Acinetobacter baumannii ATCC 17978

Length 367 aa, Gene n/a, UniProt n/a

>ABO12455.2|Acinetobacter baumannii ATCC 17978|phage putative head morphogenesis protein
MATDIKKLFEALTQHQAYLYRASSKTVNELLALFNDDTSKMLSKLRDLLDELNESEKVALAGGKYTTSNLREIRDLIAQWFASVNLALPEAFAVSATALAVYEANYVAKLYGAKINKPDGEKLFLSAKKVPLAGGALVDDLLSRIAESARQKVEYAIRDGINSGKTNQEIVQRIRGSKRLNYEDGILNGTKTDIERTVRTVRSHVANQAYLNSFNQIGFEYVRFVSVLDGRTSKLCASLDGSVWEINDPAKRVPPLHPNCRSILVPVEKDGQLVGERPFVMDERRVKDIPKEERSQLIGQLDANTTFKEFFKKTDDFFQREWLGPKRFKLYKDGKFDFEKFFDPEGRFYSLDDLRKLDEKAFKKLGL

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study1.085.9e-11○○○○○ 1.781.784965177142548524895306
Retrieved 1 of 1 entries in 9.6 ms (Link to these results)