Bacterial taxon 400667
Locus A1S_1522
Protein ABO11949.1
Predicted redox disulfide bond formation protein OsmC-like protein
Acinetobacter baumannii ATCC 17978
Length 135 aa, Gene n/a, UniProt n/a
>ABO11949.1|Acinetobacter baumannii ATCC 17978|Predicted redox disulfide bond formation protein OsmC-like protein
MVNTAQAQSTSTPYRVTLTDPSGHQWFADEPTDKGGRDTAPNPVQLLLSALGACTTITLEMYANHKGIKIEHVQVDLALNPNGDPEAGQNNIERKITLKGEFTEDQHKRLLKVAENCPIHKLLTSNITIQTELNI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.8 | 0.00042 | ○○○○○ 1.39 | 1.3886936920462996 | 24895306 |
Retrieved 1 of 1 entries in 7 ms
(Link to these results)