Bacterial taxon 400667
Locus A1S_0528
Protein ABO10981.1
protein exporting molecular chaperone
Acinetobacter baumannii ATCC 17978
Length 152 aa, Gene secB, UniProt A3M237
>ABO10981.1|Acinetobacter baumannii ATCC 17978|protein exporting molecular chaperone
MSEEQQVQPQLALERIYTKDISFEVPGAQVFTKQWQPELNINLSSAAEKIDPTHFEVSLKVVVQANNDNETAFIVDVTQSGIFLIDNIEEDRLPYILGAYCPNILFPFLREAVNDLVTKGSFPQLLLTPINFDAEFEANMQRAQAAAVEGQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.87 | 1.3e-8 | ●●○○○ -1.05 | -1.0477618935108817 | 24895306 |
Retrieved 1 of 1 entries in 14.7 ms
(Link to these results)