Bacterial taxon 400667
Locus A1S_1884
Protein ABO12311.2
protocatechuate 34-dioxygenase alpha chain (3,4-PCD)
Acinetobacter baumannii ATCC 17978
Length 209 aa, Gene n/a, UniProt n/a
>ABO12311.2|Acinetobacter baumannii ATCC 17978|protocatechuate 34-dioxygenase alpha chain (3,4-PCD)
MNNWNFQELKETPSQTGGPYVHIGLLPQQAGIEVFENNFNNQLVQDQTKGERIRLEGQVFDGLGLPLRDVLIEIWQADANGIYPSQADTREQKADPAFQGWGRTGADFETGVWSFNTIKPGATAGRKGSTQAPHIALVIFARGINLGLHTRVYFEDEAEANANDPILNSIEWAPRRQTLIAKRFEENGEVVYRFDIRIQGDDETVFFDI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.73 | 2.6e-5 | ○○○○○ 1.29 | 1.2863153076421603 | 24895306 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)