Bacterial taxon 400667
Locus A1S_2143
Protein ABO12570.2
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Acinetobacter baumannii ATCC 17978
Length 150 aa, Gene n/a, UniProt n/a
>ABO12570.2|Acinetobacter baumannii ATCC 17978|putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
MNAPETIFALALASNLDADQHFTFAYTQLATLGKVQFSSVYQIPCRDGIGDDYWNSACLLKSTLSSEQIESFLKKLESDSGRVRPSHHISLDVDLIAWGADLDHMQFNSKKLPLALDVKIPLYELWHCETLKADSTLYPVVNFKVECLSN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.49 | 0.02 | ●○○○○ -0.5 | -0.5025115929466075 | 24895306 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)