Bacterial taxon 400667
Locus A1S_1566
Protein ABO11993.2
putative 6-pyruvoyl-tetrahydropterin synthase
Acinetobacter baumannii ATCC 17978
Length 198 aa, Gene n/a, UniProt n/a
>ABO11993.2|Acinetobacter baumannii ATCC 17978|putative 6-pyruvoyl-tetrahydropterin synthase
MLIRKLFKFENAHVVRNCTSDRCKRSIHGHSYKVELLLKASKLDHGQMVYDFGLLKGVIKDLFDSFDHAICFWEKDDPQYIDACKTFSARWISLPVSPSAEQFSRIFFYLAQQVLQSTVTQNGEGDVEVYSVIVHETDTGYAQSFLEDIQNEQMGLLNLEGIIFSEQVQSEWADPNMYENLKQGIKFHNPHVNLQVEV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.95 | 3.1e-8 | ●●○○○ -1.17 | -1.1749240539876535 | 24895306 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)