Bacterial taxon 400667
Locus A1S_2376
Protein ABO12795.1
putative ABC transporter
Acinetobacter baumannii ATCC 17978
Length 89 aa, Gene n/a, UniProt n/a
>ABO12795.1|Acinetobacter baumannii ATCC 17978|putative ABC transporter
MQMQLLLSGGEKQRIGIARAFLSSAPIILLDEPTSALDQTNATRIILELSHLAKNQNKTIVMVTHDLALAAHADNRLVLKGPTDSGKSL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.12 | 2.1e-17 | ●●●○○ -2.87 | -2.872835031567761 | 24895306 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)