Bacterial taxon 400667
Locus A1S_1784
Protein ABO12211.2
putative acetyltransferase (GNAT family)
Acinetobacter baumannii ATCC 17978
Length 163 aa, Gene n/a, UniProt n/a
>ABO12211.2|Acinetobacter baumannii ATCC 17978|putative acetyltransferase (GNAT family)
MNMLNYQLVGKSDYVSAVEFALYTRQLLFPEIYHGPVPKDLQNFEQYYVHDPLGCFITVKDQNRIIGTIAYRAYDHRFDLNLPSNTVEVVKLFVLPEYRRNGIATQLCNMLFSHAQNNEITTLYLHTHPFLPAAEEFWTLQGFEVIQREWIETYDTIHMSKSL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.54 | 0.00072 | ○○○○○ 1 | 0.9981622050995496 | 24895306 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)