Bacterial taxon 400667
Locus A1S_0620
Protein ABO11069.1
putative anti-anti-sigma factor
Acinetobacter baumannii ATCC 17978
Length 173 aa, Gene n/a, UniProt n/a
>ABO11069.1|Acinetobacter baumannii ATCC 17978|putative anti-anti-sigma factor
MSTGHVEYASLNGTHIFKLIGEVRAHSCISLDKLLNRIEQQENVVGAIVDLTQTTFIDSTVLGILAKLGLKLKQTHHIQAVMLSTNPDITTLANSMGLGQVFVILNYCGDPNVCTLTLTDEHITHNAMLRTVLDAHKTLMKLNANNQNMFEPLVKQLQKEQDTLEQVSDKQNA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.46 | 4.7e-13 | ○○○○○ 3.81 | 3.8082656735267446 | 24895306 |
Retrieved 1 of 1 entries in 15.1 ms
(Link to these results)