Bacterial taxon 400667
Locus A1S_2261
Protein ABO12684.1
putative cold shock protein
Acinetobacter baumannii ATCC 17978
Length 70 aa, Gene n/a, UniProt n/a
>ABO12684.1|Acinetobacter baumannii ATCC 17978|putative cold shock protein
MTAREQGVVKWFNDTKGFGFIQRNGGDDVFVHFRAIVGDGHRSLRDGQRVEFSVVQGQKGFQAENVQPLD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.34 | 0.039 | ○○○○○ 0.71 | 0.7059697344845327 | 24895306 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)