Bacterial taxon 400667
Locus A1S_1937
Protein ABO12364.1
putative glutaredoxin-related protein
Acinetobacter baumannii ATCC 17978
Length 113 aa, Gene n/a, UniProt n/a
>ABO12364.1|Acinetobacter baumannii ATCC 17978|putative glutaredoxin-related protein
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.72 | 6.4e-11 | ●●●○○ -2.28 | -2.2838974291570975 | 24895306 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)